Sökresultat

Filtyp

Din sökning på "*" gav 577639 sökträffar

No title

Proteogenomic approaches have enabled the generat̲ion of novel information levels when compared to single omics studies although burdened by extensive experimental efforts. Here, we improved a data-independent acquisition mass spectrometry proteogenomic workflow to reveal distinct molecular features related to mammographic appearances in breast cancer. Our results reveal splicing processes detecta

No title

The nasal mucosa harbors sensory nerves containing neuropeptides such as substance P (SP), which are released by capsaicin. The neuropeptides are degraded by peptidases, e.g., neutral endopeptidase (NEP) that is present in the nasal mucosa. We studied the effect of enzymatically active recombinant NEP (rNEP) on neuropeptide-evoked secretion of nasal fluid and plasma exudation in rats. rNEP adminis

No title

The focus of this study is how intended users of the built environment are categorized in strategies, policies, and guidelines for the planning and building process. The image of the intended user reflects a disabling society that also is in conflict with established policies on a society for all. Patterns of inequality are found in the materials, both within and across groups of users. With youth

No title

Ultrafast, light-induced dynamics in copper-zinc-tin-sulfide (CZTS) photovoltaic nanoparticles are investigated through a combination of optical and x-ray transient absorption spectroscopy. Laser-pump, x-ray-probe spectroscopy on a colloidal CZTS nanoparticle ink yields element-specificity, which reveals a rapid photo-induced shift of electron density away from Cu-sites, affecting the molecular or

No title

From 1985 to 2016, the prevalence of underweight decreased, and that of obesity and severe obesity increased, in most regions, with significant variation in the magnitude of these changes across regions. We investigated how much change in mean body mass index (BMI) explains changes in the prevalence of underweight, obesity, and severe obesity in different regions using data from 2896 population-ba

No title

Traces a multifaceted discourse about Denmark in British eighteenth-century and Romantic-period cultureOffers original perspectives on British, Danish, and European Romanticism, and the relationship between themContributes to the scholarly discussion of Romantic nationalism and the emergence of the idea of ‘regional’ cultural identities in the early nineteenth centuryAddresses a wide range of Nord

No title

Re-entrant condensation results in the formation of a condensed protein regime between two critical ion concentrations. The process is driven by neutralization and inversion of the protein charge by oppositely charged ions. Re-entrant condensation of cationic proteins by the polyvalent anions, pyrophosphate and tripolyphosphate, has previously been observed, but not for citrate, which has similar

No title

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat

No title

In-cycle closed-loop combustion control has been proved to reduce cycle-to-cycle variations on emissions and indicated thermal efficiency. In this paper, the in-cycle closed-loop combustion con-trollability achieved by a pilot-main fuel injection scheme is investigated. The controllability is studied by means of the maximum reachable indicated thermal efficiency (MRE). A combustion model is used f

No title

Purpose: This study aims to explore negotiations of hope in everyday life for families where a child with spinal muscular atrophy (SMA) has received a new drug treatment. Methods: A narrative design was used, drawing on interviews and participant observations in two families with children with SMA, types 1–2, to situate family experiences of hope in everyday life. Narrative analysis was used on th

No title

Aims. Spatial distribution and growth of dust in a clumpy protoplanetary disk subject to vigorous gravitational instability and fragmentation is studied numerically with sub-au resolution using the FEOSAD code. Methods. Hydrodynamics equations describing the evolution of self-gravitating and viscous protoplanetary disks in the thin-disk limit were modified to include a dust component consisting of

No title

Gas-giant planets, like Jupiter and Saturn, acquire massive gaseous envelopes during the approximately 3 Myr-long lifetimes of protoplanetary discs. In the core accretion scenario, the formation of a solid core of around ten Earth masses triggers a phase of rapid gas accretion. Previous 3D grid-based hydrodynamical simulations found that runaway gas accretion rates correspond to approximately 10 t

No title

For the reduction of emissions and combustion noise in an internal combustion diesel engine, multiple injections are normally used. A pilot injection reduces the ignition delay of the main injection and hence the combustion noise. However, normal variations of the operating conditions, component tolerances, and aging may result in the lack of combustion i.e. pilot misfire. The result is a lower in

No title

We present the X-ray spectroscopic study of the Compton-thick (CT) active galactic nuclei (AGN) population within the Chandra Deep Field South (CDF-S) by using the deepest X-ray observation to date, the Chandra 7 Ms observation of the CDF-S. We combined an optimized version of our automated selection technique and a Bayesian Monte Carlo Markov chains (MCMC) spectral fitting procedure, to develop a

No title

Swedish measures to fight the spread of COVID-19 differ from the strategies used in other comparable countries. In contrast to the lockdown approach that has been applied in many European countries, the Swedish strategy has been based to a substantial extent on individuals taking responsibility under non-binding recommendations. This contribution explores the Swedish strategy from a constitutional

No title

The constrained indicated efficiency optimization of the set-point reference for in-cycle closed-loop combustion regulators is investigated in this article. Closed-loop combustion control is able to reduce the stochastic cyclic variations of the combustion by the adjustment of multiple-injections, a pilot and main injection in this work. The set-point is determined by the demand on engine load, bu

No title

Background: Obesity prevalence is increasing globally. Bariatric surgery is an effective treatment for severe and complex obesity resulting in significant and sustained weight loss. In Sweden, most bariatric surgery patients are referred by primary care physicians. We aimed to explore barriers for physicians to refer patients with severe and complex obesity for bariatric surgery. Methods: A questi