Sökresultat

Filtyp

Din sökning på "*" gav 564353 sökträffar

No title

Winter cover crops could contribute to more sustainable agricultural production and increase resiliency to climate change; however, their adoption remains low in California. This paper seeks to understand barriers to winter cover crop adoption by monetizing their long-term economic and agronomic impacts on farm profitability in two of California's specialty crop systems: processing tomatoes and al

No title

The standard prognostic marker for multiple myeloma (MM) patients is the revised International Staging System (R-ISS). However, there is room for improvement in guiding treatment. This applies particularly to older patients, in whom the benefit/risk ratio is reduced because of comorbidities and subsequent side effects. We hypothesized that adding gene-expression data to R-ISS would generate a stro

No title

Engineering tunable graphene-semiconductor interfaces while simultaneously preserving the superior properties of graphene is critical to graphene-based devices for electronic, optoelectronic, biomedical, and photoelectrochemical applications. Here, we demonstrate this challenge can be surmounted by constructing an interesting atomic Schottky junction via epitaxial growth of high-quality and unifor

No title

There is a strongly growing interest for wastewater heat recovery (WWHR) in Sweden and elsewhere, but a lack of adequate tools to determine downstream impacts due to the associated temperature drop. The heat recovery potential and associated temperature drop after heat recovery on a building level is modelled for a case study in Linköping, Sweden. The maximum temperature drop reaches 4.2 °C, with

No title

The aim of this study was to perform a preliminary assessment of the expected effective dose rate from external exposure to an adult individual staying at that part of the radioactively contaminated territory of the Vetka district of the Gomel region of the Republic of Belarus, from where residents had been resettled after the Chernobyl accident. For this assessment, in summer 2016 and 2018 soil s

No title

Introduction Longer travel times are associated with increased adverse maternal and perinatal outcomes. Geospatial modelling has been increasingly used to estimate geographic proximity in emergency obstetric care. In this study, we aimed to assess the correlation between modelled and patient-reported travel times and to evaluate its clinical relevance. Methods Women who delivered by caesarean sect

No title

We study exclusive production of scalar χc0χc(0++) and pseudoscalar ηc charmonia states in proton-proton collisions at the LHC energies. The amplitudes for gg→χc0 as well as for gg→ηc mechanisms are derived in the kT-factorization approach. The pp→ppηc reaction is discussed for the first time. We have calculated rapidity, transverse momentum distributions, and such correlation observables as the d

No title

This Letter presents a search for the production of new heavy resonances decaying into a Higgs boson and a photon using proton-proton collision data at s=13 TeV collected by the ATLAS detector at the LHC. The data correspond to an integrated luminosity of 139 fb-1. The analysis is performed by reconstructing hadronically decaying Higgs boson (H→bb¯) candidates as single large-radius jets. A novel

No title

In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circul

No title

Pancreatic β-cells located within the islets of Langerhans play a central role in metabolic control. The main function of these cells is to produce and secrete insulin in response to a rise in circulating levels of glucose and other nutrients. The release of insufficient insulin to cover the organism needs results in chronic hyperglycemia and diabetes development. β-cells insure a highly specializ

No title

We present a numerical model for the recently introduced simple and inexpensive micromachined aluminum devices with a polydimethylsiloxane (PDMS) cover for microparticle acoustophoresis. We validate the model experimentally for a basic design, where a microchannel is milled into the surface of an aluminum substrate, sealed with a PDMS cover, and driven at MHz frequencies by a piezoelectric lead-zi

No title

Judges should not be influenced by legally irrelevant circumstances in their legal decision making and judges generally believe that they manage legally irrelevant circumstances well. The purpose of this experimental study was to investigate whether this self-image is correct. Swedish judges (N = 256) read a vignette depicting a case of libel, where a female student had claimed on her blog that sh

No title

Central to the development of diabetic macro- and microvascular disease is endothelial dysfunction, which appears well before any clinical sign but, importantly, is potentially reversible. We previously demonstrated that hyperglycemia activates nuclear factor of activated T cells (NFAT) in conduit and medium-sized resistance arteries and that NFAT blockade abolishes diabetes-driven aggravation of

No title

Analysis of an airborne geophysical data covering the Tasiast-Tijirit Terrane in the western part of the Reguibat Shield (including the 1:200,000 geological sheets of Chami, Ahmeyim and Atar), provided an improved mapping of mafic dyke swarms, structural features, and hydrothermal alteration zones. It also extended the mapping into extensive areas covered by sand. A low-altitude (100 m) airborne s

No title

Objectives: 68Ga-DOTATOC PET targets somatostatin receptors (SSTRs) and is well established for the detection of SSTR-expressing tumors, such as gastrointestinal neuroendocrine tumors. Pituitary adenomas, recently designated as pituitary neuroendocrine tumors (PitNETs), also express SSTRs, but there has been no previous evaluations of 68Ga-DOTATOC PET in PitNET patients. The aim of this pilot stud

No title

The use of hyperbaric oxygen therapy (HBO) in the treatment of certain types of diabetic foot ulcers (DFU) has been the topic of much debate and disagreement over the last several decades. In this review, the evidence for its use is presented and discussed by two experts in DFU management. Whereas some randomized controlled trials suggest that HBO may speed the healing of certain ischaemic or neur

No title

PURPOSE: To describe a specific cone-rod dystrophy phenotype in a family with the homozygous c.1429G>A; p.Gly477Arg mutation in CRB1. The detailed phenotype of subjects with this specific mutation has not been described previously. METHODS: Clinical examination included full-field electroretinography and high-resolution and widefield retinal imaging and uveitis workup. Molecular genetic analysis i

No title

The past several decades have illustrated an enormous interest in noble metal nanoparticles for their superior catalytic activity, however, their industrial use is very restricted due to inefficient recovery leading to potential contamination of products and the environment. Immobilised nanoparticles illustrate promising results for scaling up processes, and can be successfully applied for various

No title

A search for heavy resonances decaying into a W or Z boson and a Higgs boson produced in proton-proton collisions at the Large Hadron Collider at s=13 TeV is presented. The analysis utilizes the dominant W→qq¯′ or Z→qq¯ and H→bb¯ decays with substructure techniques applied to large-radius jets. A sample corresponding to an integrated luminosity of 139 fb-1 collected with the ATLAS detector is anal