Search results

Filter

Filetype

Your search for "*" yielded 559720 hits

Incorporation of antimicrobial compounds in mesoporous silica film monolith

Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve

The impact of light and colour on psychological mood: a cross-cultural study of indoor work environments

The aim of the study was to determine whether indoor lighting and colour would have any systematic impact on the mood of people working indoors. Earlier studies have mostly focused either on light, colour or windows in laboratory settings. The present study was carried out in real work environments at different seasons and in countries with different latitudes. A total of 988 persons completed all

The effects of lipophilic substances on the shape of erythrocytes demonstrated by a new in vitro-method

Abstract Low aqueous solubility of lipophilic agents, such as free fatty acids, hampers proper in vitro demonstration of biological effects, yielding an ambiguous in vitro-in vivo correlation. We have therefore developed a method for evaluating the acute effects of lipophilic substances on the shape of erythrocytes and estimated EC50 and Hill coefficient according to the sigmoidal Emax model. T

Decreased serum level of macrophage inflammatory chemokine-3 beta/CCL19 in preterm labor and delivery

Objective: Chemokines are small soluble molecules which mediate leukocyte migration and may be involved in the pathophysiology of preterm labor. We aimed to determine if serum concentrations of selected chemokines are changed in preterm labor and delivery. Study design: A novel array-based enzyme-linked immunosorbent assay was used to quantitate serum levels of nine chemokines from a single sample

Fixation and saliency during search of natural scenes: the case of visual agnosia

Models of eye movement control in natural scenes often distinguish between stimulus-driven processes (which guide the eyes to visually salient regions) and those based on task and object knowledge (which depend on expectations or identification of objects and scene gist). In the present investigation, the eye movements of a patient with visual agnosia were recorded while she searched for objects w

In situ investigations of chemical reactions on surfaces by X-ray diffraction at atmospheric pressures

Catalytic reactions occurring at metal surfaces and nanoparticles have been an established research field for decades, yielding information on adsorption sites and reaction pathways under ultrahigh-vacuum conditions. Recent experimental developments have made it possible to perform well-controlled in situ surface x-ray diffraction measurements from single-crystal surfaces and nanoparticles under i

Theoretical characterization of the lowest-energy absorption band of pyrrole

The lowest-energy band of the electronic spectrum of pyrrole has been studied with vibrational resolution by using multiconfigurational second-order perturbation theory (CASPT2) and its multistate extension (MS-CASPT2) in conjunction with large atomic natural orbital-type basis sets including Rydberg functions. The obtained results provide a consistent picture of the recorded spectrum in the energ

Impaired dopamine storage resulting from alpha-synuclein mutations may contribute to the pathogenesis of Parkinson's disease.

Parkinson's disease (PD) is a progressive neurodegenerative disorder characterized by the inability to initiate, execute and control movement. Neuropathologically, there is a striking loss of dopamine-producing neurons in the substantia nigra pars compacta, accompanied by depletion of dopamine in the striatum. Most forms of PD are sporadic, though in some cases familial inheritance is observed. In

Cytogenetic findings in 33 osteosarcomas

Thirty-three osteosarcomas (OS) were analyzed cytogenetically. Clonal chromosome changes were detected in 17 cases. Six tumors had chromosome numbers in the diploid range, 6 in the triploid range, 1 in the tetraploid range and 1 in the pentaploid range, while 3 tumors had multiple clones with different ploidy levels. Including the present 17 tumors, a total of 27 OS with clonal aberrations have be

"A Token of Gratitude"? A Morally Ambiguous Case of Bribery

The phenomenon of bribery is characterized by its elastic features, both morally and legally. This study sets out to investigate a court case of bribery: how the people involved construct and argue for their particular version. A single case of bribery is chosen in order to clarify the range and potential of various descriptions of the very same event. The material consists of interviews with the

Long-term vegetation history of a Picea abies stand in south-western Norway : implications for the conservation of biological values

The development of a forest stand in south-eastern Norway during the last 9000 years is investigated by pollen and charcoal analyses. The aims are to identify factors that have influenced current biodiversity, which includes the lichen Usnea longissima, and examine the immigration and establishment of the current dominant tree Picea abies. Fire has been a variable but major disturbance factor at t

CYP17 genotype is associated with short menstrual cycles, early oral contraceptive use and BRCA mutation status in young healthy women

The CYP17 gene is involved in steroid hormone metabolism and has been proposed as a low penetrance gene for breast cancer. We aimed to investigate the associations between the CYP17 genotype and breast cancer risk factors, such as age at menarche, menstrual cycle length, oral contraceptive (OC) use, and BRCA mutation status among 258 healthy young women, aged <= 40, from 158 breast cancer high-ris

Cutaneous Human Papillomaviruses Persist on Healthy Skin.

Cutaneous human papillomaviruses (HPVs) are frequently found in healthy skin and have also been implicated in non-melanoma skin cancer. For genital HPV types, a persistent infection with one of the high-risk types is a prerequisite for the development of cervical cancer. However, there is only limited data on whether infections with cutaneous HPV types persist over time. Serial forehead swab sampl

The STAT4 gene influences the genetic predisposition to systemic sclerosis phenotype

The aim of this study was to investigate the possible role of STAT4 gene in the genetic predisposition to systemic sclerosis (SSc) susceptibility or clinical phenotype. A total of 1317 SSc patients [896 with limited cutaneous SSc (lcSSc) and 421 with diffuse cutaneous SSc (dcSSc)] and 3113 healthy controls, from an initial case-control set of Spanish Caucasian ancestry and five independent cohorts