Search results

Fibroblast-mediated collagen gel contraction depends on collagen-binding ss1 integrins. Perturbation of these integrins reveals an alternative contraction process that is integrin aVss3-dependent and platelet-derived growth factor (PDGF) BB-stimulated. Connective tissue cells actively control interstitial fluid pressure (IFP) and inflammation-induced lowering of IFP provides a driving force for ed

Varved lake sediments can be used to set multiple environmental proxies within a calendar year time scale. We undertook a systematic survey of lakes in the Province of Varmland, west central Sweden, with the aim of finding continuous varved lake sediment sequences covering the majority of the Holocene. In Fennoscandia, such sediments have previously only been recorded in northern Sweden and in sou

Heparan sulfate inhibits the proliferation of normal human lung fibroblasts (HFL-1) but not of a human lung carcinoma cell-line (A549). in this study we investigated possible mechanisms and structural requirements by which anti proliferative heparan sulfates exerts its effects on binding, uptake and subcellular localisation. Both HFL-1 and A549 cells were incubated with I-125- or rhodamine-labeled

A series of triclinic Fe1−xAlxVO4 phases with 0 <= x <= 1 were prepared and used in the oxidation of methanol to formaldehyde. The activity measurements revealed that both the activity and especially the selectivity to formaldehyde increased with time of operation for at least 16 h, indicating restructuring of the catalysts. Characterisation of the catalysts with XRD, XANES, and electron microscop

Nuclear spin relaxation by intermolecular dipole–dipole interactions between macromolecular and solvent nuclear moments forms the basis of a widely used method for investigating macromolecular solvation. In particular, intermolecular cross-relaxation [or nuclear Overhauser effect (NOE)] between protein and water protons has been used to probe the mobility of water molecules interacting with the pr

The redshank (Tringa totanus) is declining throughout Europe and to implement efficient conservation measures, it is important to obtain information about the population genetic structure. The aim of the present study was two-fold. First, we analysed the genetic variation within and between populations in the Baltic region in southern Scandinavia. Evidence of genetic structure would suggest that d

The frequency of micronuclei (MN) in peripheral blood lymphocytes (PBL) is extensively used as a biomarker of chromosomal damage and genome stability in human populations. Much theoretical evidence has been accumulated supporting the causal role of MN induction in cancer development, although prospective cohort studies are needed to validate MN as a cancer risk biomarker. A total of 6718 subjects

Introduction: Activation recovery time (ART), defined as the time from the earliest ventricular activation time to the end of T wave on unipolar electrograms, has been used as an index of myocardial repolarization time. However, it is unknown whether the ART can be used to estimate the global sequence and dispersion of ventricular repolarization as determined by the monophasic action potential (MA

The oxyntic mucosa of the mammalian stomach is rich in endocrine cells, such as ECL cells, A-like cells, somatostatin cells, D1/P cells and, in some species, enterochromaffin cells. The various endocrine cell types can be distinguished on the basis of their characteristic cytoplasmic granules and vesicles. The ECL cells contain numerous large secretory vesicles and relatively few, small electron-d

Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve

The rat neural cell line RN33B has a remarkable ability to undergo region-specific neuronal differentiation after transplantation into the CNS. To further study its neurogenic properties in vivo, we used a recombinant lentiviral vector to genetically label the cells with the Green Fluorescent Protein (GFP) gene before implantation into the striatum/cortex, hippocampus, or mesencephalon of newborn

Background. Infection with Helicobacter pylori is associated with an increased risk of gastric cancer. Several studies have indicated that the association differs with strain type. We aimed to find out if infection with strains lacking the virulence factor CagA is linked to gastric cancer risk. Materials and methods. In a hospital-based case-control study, we collected sera from 100 case patients

We have seen that protein kinase Calpha (PKCalpha) is transiently translocated to the plasma membrane by carbachol stimulation of neuroblastoma cells. This is induced by the Ca2+ increase, and PKCalpha does not respond to diacylglycerol (DAG). The unresponsiveness is dependent on structures in the catalytic domain of PKCalpha. This study was designed to investigate if and how the kinase activity a

Questions: (1) Does soil acidification in calcareous sandy grasslands lead to loss of plant diversity? (2) What is the relationship between the soil content of lime and the plant availability of mineral nitrogen (N) and phosphorus (P) in sandy grasslands? Location: Sandy glaciofluvial deposits in south-eastern Sweden covered by xeric sand calcareous grasslands (EU habitat directive 6120). Methods: