Filtyp
Interviews where photographs taken by the respondent are used in order to stimulate the conversation and to gain rich empirical material are increasingly employed by researchers. The ubiquitous use of mobile cameras and digital platforms such as Instagram has made it easier for the researcher as well as for the interviewees to take and share photographs. The limitations of participatory visual met
An experimental investigation of surface pressure distributions (mean and r.m.s.) on two tubes (circular cylinders) mounted in an in-line or tandem arrangement was carried out in a low-speed, closed-circuit wind tunnel. The measurements were mainly performed at a subcritical Reynolds number, Re = 2·0 × 104, at three different turbulence intensities of the approaching cross-flow (0·1, 1·4 and 3·2%)
Many exegetes set out to analyse not only rhetorical features in Galatians but also other features relating to Paul’s argumentation. Still, the use of insights from modern argumentation theory has been modest and no full-fledged argumentation analyses of Paul’s argumentation have yet been attempted. However, modern methods for argumentation analysis provide useful tools for such an undertaking. UsMany exegetes set out to analyse not only rhetorical features in Galatians but also other features relating to Paul’s argumentation. Still, the use of insights from modern argumentation theory has been modest and no full-fledged argumentation analyses of Paul’s argumentation have yet been attempted. However, modern methods for argumentation analysis provide useful tools for such an undertaking. Us
Radioresistance, the failure to achieve a desired outcome, is an obstacle in clinical radiotherapy. In this thesis we investigate factors affecting radioresistance and strategies to overcome it, both with established clinical approaches and by using novel pre-clinical discoveries. Study I & II concern the impact of tumour volume in patients with oropharyngeal cancer. In a large, pooled cohort
Current food systems pose one of the greatest health and environmental challenges of the 21st century. Expanded utilization of seaweed for food in Western societies seems like one promising measure in the transition toward sustainable food systems. However, introducing and expanding seaweed to new markets brings certain challenges, such as limited food acceptance and availability. In this pilot coCurrent food systems pose one of the greatest health and environmental challenges of the 21st century. Expanded utilization of seaweed for food in Western societies seems like one promising measure in the transition toward sustainable food systems. However, introducing and expanding seaweed to new markets brings certain challenges, such as limited food acceptance and availability. In this pilot co
The oxidative addition of iodine to Pt(CN)42− is first-order with respect to iodide, iodine and complex. The reverse reductive elimination of iodide from trans-Pt(CN)4I22- is first-order with respect to iodide and Pt(CN)4I22−. The kinetics for the reaction between bromide and trans-Pt(CN)4ClH2O2− involves a rate-determining reductive elimination of chloride, followed by a rapid oxidative addition
Chloride and bromide anations of PdX(H2O)3+, cis-PdX2(H2O)2 and trans-PdX2(H2O)2, acid hydrolyses of PdX3H2O−, cis-PdX2(H2O)2 and trans-PcX2(H2O)2, X = Cl, Br, have been studied at different temperatures by means of a stopped-flow technique. Rate constants and activation parameters are given. The palladium complexes react about 5×104 to 5×105 times faster than the analogous platinum(II) complexes.Chloride and bromide anations of PdX(H2O)3+, cis-PdX2(H2O)2 and trans-PdX2(H2O)2, acid hydrolyses of PdX3H2O−, cis-PdX2(H2O)2 and trans-PcX2(H2O)2, X = Cl, Br, have been studied at different temperatures by means of a stopped-flow technique. Rate constants and activation parameters are given. The palladium complexes react about 5×104 to 5×105 times faster than the analogous platinum(II) complexes.
Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number
The edited volume Methods for Studying Video Games and Religion (2017) by Vít Šisler, Kerstin Radde-Antweiler, and Xenia Zeiler takes the study of religion and video games seriously and recognizes the widespread usage of religious themes in the world of games. The book can be read as an exposé of the state of research in the field of Game Stud-ies with the specific focus on methods for researching
This study delineates the permissible scope for compulsory mental health interventions under the Convention on the Rights of Persons with Disabilities (CRPD). It was initially triggered by two competing positions within the current debate over the future of coercive psychiatry; a practice that is still omnipresent among states worldwide. According to one position, defended by the CRPD Committee am
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
This thesis is a documentation as well as a reflection on the participation of Sweden‘s third most populous municipality, Malmö, in Shanghai‘s World Exposition (Expo) during summer 2010. Based on my own involvement as a staff member for 1.5 months, in the thesis I wish to explore eco-branding at Malmö‘s official showcase (Malmö Case). I want to look at Malmö‘s eco-branding in an overseas context,
Most bilateral tax treaties contain provisions with the objective of preventing different types of treaty abuse. Limitation on benefits clauses are an example of such provisions, and are generally found in United States tax treaties. These include various tests, which need to be fulfilled by a taxpayer wishing to enjoy the benefits of a tax treaty. Most of the United States tax treaties with EU Me
Idag använder allt fler näringsidkare internet och sociala medier för att nå ut med sina budskap. Genom dessa medier har de fått nya möjligheter att sprida information. Mot bakgrund av att information på sociala medier ofta uppfattas som personliga och trovärdiga tips har näringsidkare också insett fördelen med att sprida marknadsföring som kanske inte uppfattas som marknadsföring. Så kallad dold Today more and more businesses are using the internet and social media to reach out with their messages. Through these media, they have found new opportunities to disseminate information. Given that information on social media sites often is perceived as personal and credible advice, consumers may easily mistake marketing for information. Traders have recognized the advantage of confusing marketin
Ultrashort laser pulses play an important role in many applications in science and technology, from attosecond science to time resolved spectroscopy and material processing. For applications of ultrashort laser pulses, it requires a complete characterization of the electric field of the pulse, which includes both phase and amplitude of the electric field. The characterization of ultrashort laser pThe human eye can clearly observe movements as fast as around 0.1 seconds long, but how can we observe the movement that is way too fast for the human eye? For example, you can barely read any labels from a really fast moving formula 1 car. However, if we use a camera which can act faster than the human eye, we can capture the images of the moving object. When a camera takes a picture, it records
The purpose of this study is to generate a deeper understanding of the influence of social environments on individuals’ responsible consumption behavior. Based on between-group and within-group comparisons of data obtained from an online survey, we conducted one-way and factorial ANOVA tests. This study contributes to a better understanding of the variability in responsible consumption behaviors.
This study investigates the possibilities to provide the end consumers of energy with information and statistics about their consumption in the form of a smartphone application. The report includes both electricity and district heating, but the focus is on electricity consumption. Earlier studies show potential savings up to 15-20% when real time energy usage information is supplied to the end use
